EGFR Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11351
Artikelname: EGFR Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11351
Hersteller Artikelnummer: A11351
Alternativnummer: ABB-A11351-100UL,ABB-A11351-20UL,ABB-A11351-500UL,ABB-A11351-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2, EGFR
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 1956
UniProt: P00533
Reinheit: Affinity purification
Sequenz: QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Target-Kategorie: EGFR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,G protein signaling,Kinase,Tyrosine kinases,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Cardiovascular,Angiogenesis