Fibrillarin/U3 RNP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Fibrillarin/U3 RNP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1136
• Hersteller Artikelnummer: A1136
• Alternativnummer: ABB-A1136-1000UL,ABB-A1136-20UL,ABB-A1136-100UL,ABB-A1136-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FIB, FLRN, Nop1, RNU3IP1, Fibrillarin/U3 RNP

Produktbeschreibung

This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Produkteigenschaften

• Molekulargewicht: 34kDa
• NCBI: 2091
• UniProt: P22087
• Reinheit: Affinity purification
• Sequenz: RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
• Target-Kategorie: FBL

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Monkey. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding

Bilder