LDHA Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: LDHA Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1146
• Hersteller Artikelnummer: A1146
• Alternativnummer: ABB-A1146-100UL,ABB-A1146-20UL,ABB-A1146-500UL,ABB-A1146-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LDHM, GSD11, PIG19, HEL-S-133P, LDHA

Produktbeschreibung

The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 26-39 kDa
• NCBI: 3939
• UniProt: P00338
• Reinheit: Affinity purification
• Sequenz: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLS
• Target-Kategorie: LDHA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5ug-4ug antibody for 200ug-400ug extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect

Bilder