MCM3 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11475
Artikelname: MCM3 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11475
Hersteller Artikelnummer: A11475
Alternativnummer: ABB-A11475-100UL,ABB-A11475-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HCC5, P1.h, RLFB, P1-MCM3, MCM3
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0607]
Molekulargewicht: 91kDa
NCBI: 4172
UniProt: P25205
Reinheit: Affinity purification
Sequenz: MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV
Target-Kategorie: MCM3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Centrosome