hnRNP A1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11564
Artikelname: hnRNP A1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11564
Hersteller Artikelnummer: A11564
Alternativnummer: ABB-A11564-100UL,ABB-A11564-20UL,ABB-A11564-1000UL,ABB-A11564-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: UP 1, ALS19, ALS20, HNRPA1, IBMPFD3, HNRPA1L3, hnRNP A1, hnRNP-A1
This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.hnRNP A1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0633]
Molekulargewicht: 39kDa
NCBI: 3178
UniProt: P09651
Reinheit: Affinity purification
Sequenz: DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
Target-Kategorie: HNRNPA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:1000|IF/ICC,1:200 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding