Na+/K+-ATPase Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11683
Artikelname: Na+/K+-ATPase Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11683
Hersteller Artikelnummer: A11683
Alternativnummer: ABB-A11683-100UL,ABB-A11683-20UL,ABB-A11683-500UL,ABB-A11683-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CMT2DD, HOMGSMR2, Na+/K+-ATPase
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0674]
Molekulargewicht: 113kDa
NCBI: 476
UniProt: P05023
Reinheit: Affinity purification
Sequenz: MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Target-Kategorie: ATP1A1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:50000 - 1:200000|IF/ICC,1:100 - 1:1000|IF-P,1:100 - 1:1000|IHC-P,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,Endocrine Metabolism