NMDAR1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11699
Artikelname: NMDAR1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11699
Hersteller Artikelnummer: A11699
Alternativnummer: ABB-A11699-100UL,ABB-A11699-20UL,ABB-A11699-1000UL,ABB-A11699-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NR1, MRD8, GluN1, NMDA1, DEE101, NDHMSD, NDHMSR, NMD-R1, NMDAR1
The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0684]
Molekulargewicht: 105kDa
NCBI: 2902
UniProt: Q05586
Reinheit: Affinity purification
Sequenz: SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
Target-Kategorie: GRIN1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Protein phosphorylation,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease.