ASC/TMS1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ASC/TMS1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1170
• Hersteller Artikelnummer: A1170
• Alternativnummer: ABB-A1170-100UL,ABB-A1170-20UL,ABB-A1170-500UL,ABB-A1170-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ASC, TMS, TMS1, CARD5, TMS-1, ASC/TMS1

Produktbeschreibung

This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm, however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 29108
• UniProt: Q9ULZ3
• Reinheit: Affinity purification
• Sequenz: LDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
• Target-Kategorie: PYCARD
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Apoptosis,Caspases.

Bilder