STUB1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11751
Artikelname: STUB1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11751
Hersteller Artikelnummer: A11751
Alternativnummer: ABB-A11751-20UL,ABB-A11751-100UL,ABB-A11751-1000UL,ABB-A11751-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CHIP, SCA48, UBOX1, SCAR16, HSPABP2, NY-CO-7, SDCCAG7, STUB1
This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 10273
UniProt: Q9UNE7
Reinheit: Affinity purification
Sequenz: MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRK
Target-Kategorie: STUB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway.