Connexin 43 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11752
Artikelname: Connexin 43 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11752
Hersteller Artikelnummer: A11752
Alternativnummer: ABB-A11752-20UL,ABB-A11752-100UL,ABB-A11752-500UL,ABB-A11752-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HSS, CMDR, CX43, EKVP, GJAL, ODDD, AVSD3, EKVP3, HLHS1, PPKCA, Connexin 43
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 2697
UniProt: P17302
Reinheit: Affinity purification
Sequenz: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Target-Kategorie: GJA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,Cardiovascular,Heart,Cardiac arrhythmias.