EpCAM Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1177
- Bilder (2)
| Artikelname: | EpCAM Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1177 |
| Hersteller Artikelnummer: | A1177 |
| Alternativnummer: | ABB-A1177-20UL,ABB-A1177-100UL,ABB-A1177-500UL,ABB-A1177-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ESA, KSA, M4S1, MK-1, DIAR5, EGP-2, EGP40, KS1/4, MIC18, TROP1, BerEp4, EGP314, HNPCC8, LYNCH8, MOC-31, Ber-Ep4, TACSTD1, EpCAM |
| This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 35kDa |
| NCBI: | 4072 |
| UniProt: | P16422 |
| Reinheit: | Affinity purification |
| Sequenz: | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Target-Kategorie: | EPCAM |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs. |


