CD8A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11856
Artikelname: CD8A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11856
Hersteller Artikelnummer: A11856
Alternativnummer: ABB-A11856-100UL,ABB-A11856-20UL,ABB-A11856-1000UL,ABB-A11856-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CD8, p32, Leu2, CD8alpha, CD8A
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 925
UniProt: P01732
Reinheit: Affinity purification
Sequenz: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Target-Kategorie: CD8A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Immunology Inflammation,CDs,Stem Cells.