CDC42 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CDC42 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1188
• Hersteller Artikelnummer: A1188
• Alternativnummer: ABB-A1188-20UL,ABB-A1188-100UL,ABB-A1188-500UL,ABB-A1188-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TKS, G25K, CDC42Hs, CDC42

Produktbeschreibung

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 21kDa
• NCBI: 998
• UniProt: P60953
• Reinheit: Affinity purification
• Sequenz: DLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
• Target-Kategorie: CDC42
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,G protein signaling,Small G proteins,Kinase,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Adhesion,Cytoskeleton,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,Cytokines,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway.

Bilder