KDM3A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: KDM3A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A11960
• Hersteller Artikelnummer: A11960
• Alternativnummer: ABB-A11960-20UL,ABB-A11960-100UL,ABB-A11960-500UL,ABB-A11960-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A, KDM3A

Produktbeschreibung

Enables androgen receptor binding activity, histone H3-methyl-lysine-9 demethylase activity, and iron ion binding activity. Involved in several processes, including androgen receptor signaling pathway, formaldehyde biosynthetic process, and histone H3-K9 demethylation. Located in nucleoplasm. Implicated in cervical cancer and colon cancer. Biomarker of Ewing sarcoma, hepatocellular carcinoma, nasopharynx carcinoma, and prostate cancer.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 147kDa
• NCBI: 55818
• UniProt: Q9Y4C1
• Reinheit: Affinity purification
• Sequenz: PVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQCEQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQENPADHDPIHDQSWYLDRSLRKRLHQEYGVQ
• Target-Kategorie: KDM3A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones.

Bilder