ATG16L1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11969
Artikelname: ATG16L1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11969
Hersteller Artikelnummer: A11969
Alternativnummer: ABB-A11969-20UL,ABB-A11969-100UL,ABB-A11969-500UL,ABB-A11969-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IBD10, WDR30, APG16L, ATG16A, ATG16L, ATG16L1
The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 55054
UniProt: Q676U5
Reinheit: Affinity purification
Sequenz: QEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Target-Kategorie: ATG16L1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Heart.