PGC1alpha Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11971
Artikelname: PGC1alpha Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11971
Hersteller Artikelnummer: A11971
Alternativnummer: ABB-A11971-100UL,ABB-A11971-20UL,ABB-A11971-500UL,ABB-A11971-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1(alpha), PGC1alpha
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 10891
UniProt: Q9UBK2
Reinheit: Affinity purification
Sequenz: HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNL
Target-Kategorie: PPARGC1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Nucleotide metabolism,AMPK Signaling Pathway,Endocrine and metabolic diseases,Diabetes,Obesity,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids,Fatty Acids.