CREB1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11989
Artikelname: CREB1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11989
Hersteller Artikelnummer: A11989
Alternativnummer: ABB-A11989-20UL,ABB-A11989-100UL,ABB-A11989-500UL,ABB-A11989-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CREB, CREB-1, CREB1
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 1385
UniProt: P16220
Reinheit: Affinity purification
Sequenz: MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIR
Target-Kategorie: CREB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,G protein signaling,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.