S100A8 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A12018
Artikelname: S100A8 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A12018
Hersteller Artikelnummer: A12018
Alternativnummer: ABB-A12018-100UL,ABB-A12018-20UL,ABB-A12018-500UL,ABB-A12018-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG, S100-A8, S100A8
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0478]
Molekulargewicht: 11 kDa
NCBI: 6279
UniProt: P05109
Reinheit: Affinity purification
Sequenz: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Target-Kategorie: S100A8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience, Cell Type Marker.