MMP3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1202
Artikelname: MMP3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1202
Hersteller Artikelnummer: A1202
Alternativnummer: ABB-A1202-20UL,ABB-A1202-100UL,ABB-A1202-500UL,ABB-A1202-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SL-1, STMY, STR1, CHDS6, MMP-3, STMY1, MMP3
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 4314
UniProt: P08254
Reinheit: Affinity purification
Sequenz: VRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Target-Kategorie: MMP3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis.