COPZ1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: COPZ1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12148
• Hersteller Artikelnummer: A12148
• Alternativnummer: ABB-A12148-100UL,ABB-A12148-20UL,ABB-A12148-1000UL,ABB-A12148-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: COPZ, CGI-120, HSPC181, zeta-COP, zeta1-COP, COPZ1

Produktbeschreibung

This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 22818
• UniProt: P61923
• Reinheit: Affinity purification
• Sequenz: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
• Target-Kategorie: COPZ1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction.

Bilder