SNRPF Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12162
Artikelname: SNRPF Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12162
Hersteller Artikelnummer: A12162
Alternativnummer: ABB-A12162-100UL,ABB-A12162-20UL,ABB-A12162-1000UL,ABB-A12162-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SMF, Sm-F, snRNP-F, SNRPF
Enables RNA binding activity. Involved in spliceosomal snRNP assembly. Located in cytosol and nucleus. Part of several cellular components, including methylosome, nucleus, and pICln-Sm protein complex. Biomarker of nasopharynx carcinoma.
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 6636
UniProt: P62306
Reinheit: Affinity purification
Sequenz: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Target-Kategorie: SNRPF
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.