AK1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: AK1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1218
• Hersteller Artikelnummer: A1218
• Alternativnummer: ABB-A1218-20UL,ABB-A1218-100UL,ABB-A1218-500UL,ABB-A1218-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HTL-S-58j, AK1

Produktbeschreibung

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene shares readthrough transcripts with the upstream ST6GALNAC6 gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 203
• UniProt: P00568
• Reinheit: Affinity purification
• Sequenz: MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• Target-Kategorie: AK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Cardiovascular,Heart.

Bilder