AMPKalpha1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: AMPKalpha1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1229
• Hersteller Artikelnummer: A1229
• Alternativnummer: ABB-A1229-100UL,ABB-A1229-20UL,ABB-A1229-500UL,ABB-A1229-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AMPK, AMPKa1, AMPK alpha 1, AMPKalpha1

Produktbeschreibung

The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 64kDa
• NCBI: 5562
• UniProt: Q13131
• Reinheit: Affinity purification
• Sequenz: ETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVS
• Target-Kategorie: PRKAA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Warburg Effect,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Hypoxia,Lipids,Fatty Acids.