CD3D Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1238
Artikelname: CD3D Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1238
Hersteller Artikelnummer: A1238
Alternativnummer: ABB-A1238-100UL,ABB-A1238-20UL,ABB-A1238-500UL,ABB-A1238-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: T3D, IMD19, CD3DELTA, CD3-DELTA, CD3D
The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 915
UniProt: P04234
Reinheit: Affinity purification
Sequenz: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Target-Kategorie: CD3D
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Immunology Inflammation,CDs,T Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors.