ACP1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12390
Artikelname: ACP1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12390
Hersteller Artikelnummer: A12390
Alternativnummer: ABB-A12390-20UL,ABB-A12390-100UL,ABB-A12390-500UL,ABB-A12390-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HAAP, LMWPTP, LMW-PTP, ACP1
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 52
UniProt: P24666
Reinheit: Affinity purification
Sequenz: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Target-Kategorie: ACP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle.