CD3E Antigen Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12415
Artikelname: CD3E Antigen Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12415
Hersteller Artikelnummer: A12415
Alternativnummer: ABB-A12415-20UL,ABB-A12415-100UL,ABB-A12415-1000UL,ABB-A12415-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: T3E, TCRE, IMD18, CD3epsilon, CD3E Antigen
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 916
UniProt: P07766
Reinheit: Affinity purification
Sequenz: YLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Target-Kategorie: CD3E
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,T Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors.