A1CF Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13087
Artikelname: A1CF Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13087
Hersteller Artikelnummer: A13087
Alternativnummer: ABB-A13087-100UL,ABB-A13087-20UL,ABB-A13087-500UL,ABB-A13087-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACF, ASP, ACF64, ACF65, APOBEC1CF, A1CF
Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 29974
UniProt: Q9NQ94
Reinheit: Affinity purification
Sequenz: APPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
Target-Kategorie: A1CF
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.