SCYL2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13178
Artikelname: SCYL2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13178
Hersteller Artikelnummer: A13178
Alternativnummer: ABB-A13178-20UL,ABB-A13178-100UL,ABB-A13178-500UL,ABB-A13178-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AMC4, AMCNACC, CVAK104, SCYL2
The protein encoded by this gene associates with clathrin-coated complexes at the plasma membrane and with endocytic coated vesicles. The encoded protein phosphorylates the beta2 subunit of the plasma membrane adapter complex AP2 and interacts with clathrin, showing involvement in clathrin-dependent pathways between the trans-Golgi network and the endosomal system. In addition, this protein has a role in the Wnt signaling pathway by targeting frizzled 5 (Fzd5) for lysosomal degradation. Two transcript variants encoding the same protein have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 55681
UniProt: Q6P3W7
Reinheit: Affinity purification
Sequenz: MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTV
Target-Kategorie: SCYL2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction.