TDP-43/TARDBP Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13405
Artikelname: TDP-43/TARDBP Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13405
Hersteller Artikelnummer: A13405
Alternativnummer: ABB-A13405-100UL,ABB-A13405-20UL,ABB-A13405-1000UL,ABB-A13405-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALS10, TDP-43, TDP-43/TARDBP
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 23435
UniProt: Q13148
Reinheit: Affinity purification
Sequenz: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV
Target-Kategorie: TARDBP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Neurodegenerative Diseases Markers,Other Neurological disorders.