[KO Validated] MAP3K1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] MAP3K1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A18041
• Hersteller Artikelnummer: A18041
• Alternativnummer: ABB-A18041-100UL,ABB-A18041-20UL,ABB-A18041-500UL,ABB-A18041-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MEKK, MEKK1, SRXY6, MEKK 1, MAPKKK1, K1

Produktbeschreibung

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 164kDa
• NCBI: 4214
• UniProt: Q13233
• Reinheit: Affinity purification
• Sequenz: TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
• Target-Kategorie: MAP3K1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Toll-like Receptor Signaling Pathway.

Bilder

Western blot analysis of various lysates using MAP3K1 (A18041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embeddedHuman lung cancer tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Western blot analysis of lysates from wild type (WT) and MAP3K1 knockout (KO) HeLa cells, using [KO Validated] MAP3K1 Rabbit pAb (A18041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Immunohistochemistry analysis of paraffin-embeddedHuman liver cancer tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman esophagus tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse liver tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse spleen tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedRat spleen tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedRat liver tissue usingMAP3K1 Rabbit pAb(A18041) at a dilution of 1:100 (40x lens).Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.