[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb, Unconjugated

Artikelnummer: ABB-A19068
Artikelname: [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb, Unconjugated
Artikelnummer: ABB-A19068
Hersteller Artikelnummer: A19068
Alternativnummer: ABB-A19068-20UL,ABB-A19068-100UL,ABB-A19068-1000UL,ABB-A19068-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BR, GPIa, CD49B, HPA-5, VLA-2, VLAA2, b)
This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0457]
Molekulargewicht: 129kDa
NCBI: 3673
UniProt: P17301
Reinheit: Affinity purification
Sequenz: GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
Target-Kategorie: ITGA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Endocrine Metabolism,Immunology Inflammation,CDs.
Western blot analysis of various lysates, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from wild type(WT) and Integrin alpha 2 (ITGA2/CD49b) knockout (KO) 293T cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of lysates from A549 cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.