SARS-CoV-2 Spike S2 Rabbit pAb

Artikelnummer: ABB-A20284
Artikelname: SARS-CoV-2 Spike S2 Rabbit pAb
Artikelnummer: ABB-A20284
Hersteller Artikelnummer: A20284
Alternativnummer: ABB-A20284-100UL,ABB-A20284-20UL,ABB-A20284-500UL,ABB-A20284-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike S2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Klonalität: Polyclonal
Molekulargewicht: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Reinheit: Affinity purification
Sequenz: ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
Target-Kategorie: Spike S2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: SARS-CoV-2
Immunoprecipitation analysis of 300 µg extracts of 293T cells using 3 µg SARS-CoV-2 Spike S2 antibody (A20284). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike S2 antibody (A20284) at a dilution of 1:3000.
Western blot analysis of extracts of normal 293T cells and 293T transfected with Spike S2 Protein, using SARS-CoV-2 Spike S2 Rabbit pAb (A20284) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.