SARS-CoV-2 Spike S1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SARS-CoV-2 Spike S1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A20604
• Hersteller Artikelnummer: A20604
• Alternativnummer: ABB-A20604-100UL,ABB-A20604-20UL,ABB-A20604-1000UL,ABB-A20604-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Virus
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: E2, SARS-CoV-2 Spike S1, sars-cov-2

Produktbeschreibung

The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion, Defines the range of the hosts and specificity of the virus, Main component to bind with the neutralizing antibody, Key target for vaccine design, Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 139kDa
• NCBI: 1489668
• UniProt: P59594
• Reinheit: Affinity purification
• Sequenz: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG
• Target-Kategorie: Spike S1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: SARS-CoV

Bilder

Western blot analysis of various lysates using SARS-CoV-2 Spike S1 Rabbit pAb (A20604) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.