SARS-CoV-2 Spike S1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A20834
Artikelname: SARS-CoV-2 Spike S1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A20834
Hersteller Artikelnummer: A20834
Alternativnummer: ABB-A20834-20UL,ABB-A20834-100UL,ABB-A20834-500UL,ABB-A20834-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike S1
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51489]
Molekulargewicht: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Reinheit: Affinity purification
Sequenz: YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
Target-Kategorie: Spike S1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: SARS-CoV-2, ResearchArea: Microbiology,Organism,Virus,RNA Virus,ssRNA positive strand virus,SARS Coronavirus.