[KO Validated] AKT1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: [KO Validated] AKT1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A21393
• Hersteller Artikelnummer: A21393
• Alternativnummer: ABB-A21393-1000UL,ABB-A21393-200UL,ABB-A21393-500UL,ABB-A21393-50UL,ABB-A21393-100UL,ABB-A21393-20UL,ABB-A21393-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 381-480 of human AKT1 (NP_005154.2).
• Konjugation: Unconjugated
• Alternative Synonym: AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA, T1

Produktbeschreibung

This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 56kDa
• NCBI: 207
• UniProt: P31749
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
• Target-Kategorie: AKT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,PI3K-Akt Signa