MAP2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: MAP2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A22205
• Hersteller Artikelnummer: A22205
• Alternativnummer: ABB-A22205-20UL,ABB-A22205-100UL,ABB-A22205-500UL,ABB-A22205-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAP-2, MAP2A, MAP2B, MAP2C, MAP2

Produktbeschreibung

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC56279]
• Molekulargewicht: 200 kDa
• NCBI: 4133
• UniProt: P11137
• Reinheit: Affinity purification
• Sequenz: MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD
• Target-Kategorie: MAP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:12000|IF-F,1:200 - 1:800|IF-P,1:100 - 1:400|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker.

Bilder

Western blot analysis of various lysates using MAP2 Rabbit mAb (A22205) at 1:11000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-937
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using MAP2 Rabbit mAb (A22205) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using MAP2 Rabbit mAb (A22205) at 1:11000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using MAP2 Rabbit mAb (A22205) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using MAP2 Rabbit mAb (A22205) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using MAP2 Rabbit mAb (A22205) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging ofparaffin-embedded Rat brain usingMAP2 Rabbit mAb (A22205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging ofparaffin-embedded Mouse brain usingMAP2 Rabbit mAb (A22205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of frozen sections Mouse brain tissue using MAP2 Rabbit mAb (A22205, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.