MonoMethyl-Histone H4-K20 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: MonoMethyl-Histone H4-K20 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A22572
• Hersteller Artikelnummer: A22572
• Alternativnummer: ABB-A22572-100UL,ABB-A22572-20UL,ABB-A22572-1000UL,ABB-A22572-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: DOT, ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, H4C16, HIST2H4, HIST2H4A, MonoMethyl-Histone H4-K20

Produktbeschreibung

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated, this record represents the centromeric copy.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC54049]
• Molekulargewicht: 11kDa
• NCBI: 8359
• UniProt: P62805
• Reinheit: Affinity purification
• Sequenz: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
• Target-Kategorie: Histone H4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|DB,1:500 - 1:1000|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted), ResearchArea: Epigenetics Nuclear Signaling.

Bilder

Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H4-K20 antibody (A22572) at 1:1000 dilution.

Immunohistochemistry analysis of paraffin-embeddedRat testis tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of various lysates, using MonoMethyl-Histone H4-K20 Rabbit mAb (A22572) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embeddedRat spleen tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse testis tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedRat lung tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman breast cancer tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse kidney tissue usingMonoMethyl-Histone H4-K20 Rabbit mAb(A22572) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.