Integrin-beta1/CD29 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A23497
Artikelname: Integrin-beta1/CD29 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A23497
Hersteller Artikelnummer: A23497
Alternativnummer: ABB-A23497-100UL,ABB-A23497-1000UL,ABB-A23497-20UL,ABB-A23497-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, FC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CD29, FNRB, MDF2, VLAB, GPIIA, MSK12, VLA-BETA, Integrin-beta1/CD29
Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52470]
Molekulargewicht: 88 kDa
NCBI: 3688
UniProt: P05556
Reinheit: Affinity purification
Sequenz: MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAI
Target-Kategorie: ITGB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:10000 - 1:30000|IHC-P,1:1000 - 1:5000|IF/ICC,1:100 - 1:400|FC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Neuroscience, Cell Type Marker,Stem Cells,Embryonic Stem Cells,Mesenchymal Stem Cells.
Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Integrin-beta1/CD29 Rabbit mAb (A23497) at dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Integrin-beta1/CD29 Rabbit mAb (A23497) at dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from A-431 cells using Integrin-beta1/CD29 Rabbit mAb (A23497) at 1:22000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of A-431 cells using Integrin-beta1/CD29 Rabbit mAb (A23497) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C6 cells using Integrin-beta1/CD29 Rabbit mAb (A23497) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of Neuro-2a cells using Integrin-beta1/CD29 Rabbit mAb (A23497) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Flow cytometry: 1X10 6 HL-60 cells (Low Expression,left)and A549 cells (right) were surface-stained with Rabbit anti-Human Integrin-beta1/CD29 mAb (A27614,2 µg/mL,orange line) or Rabbit IgG isotype control (AC042,2 µg/mL,blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10 6 A549 cells were surface-stained with Rabbit IgG isotype control (AC042,2 µg/mL,left) or Rabbit anti-Human Integrin-beta1/CD29 mAb (A27614,2 µg/mL,right), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining.
Flow cytometry: 1X10 6 A549 cells were surface-stained with Rabbit IgG isotype control (AC042,2 µg/mL,left) or Rabbit anti-Human Integrin-beta1/CD29 mAb (A27614,2 µg/mL,right), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining.