TROP-2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: TROP-2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A24170
• Hersteller Artikelnummer: A24170
• Alternativnummer: ABB-A24170-500UL,ABB-A24170-100UL,ABB-A24170-20UL,ABB-A24170-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, FC, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EGP1, GP50, M1S1, EGP-1, TROP2, GA7331, GA733-1, TROP-2

Produktbeschreibung

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC51505]
• Molekulargewicht: 36kDa
• NCBI: 4070
• UniProt: P09758
• Reinheit: Affinity purification
• Sequenz: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
• Target-Kategorie: TACSTD2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:200 - 1:800|IF/ICC,1:200 - 1:800|FC,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Cancer,Tumor biomarkers,Signal Transduction.

Bilder

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TROP-2 Rabbit mAb (A24170) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using TROP-2 Rabbit mAb (A24170) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Western blot analysis of lysates from MCF7 cells usingTROP-2 Rabbit mAb (A24170) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TROP-2 Rabbit mAb (A24170) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using TROP-2 Rabbit mAb (A24170) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using TROP-2 Rabbit mAb (A24170) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Confocal imaging of MCF7 cells usingTROP-2 Rabbit mAb (A24170,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow cytometry: 1X10 6 U-118MG cells (negative control,left)and MCF-7 cells (right) were surface-stained with TROP-2 Rabbit mAb (A24170,2.5 µg/mL,orange line) or ABflo 647 Rabbit IgG isotype control (A22070,5 µl/Test,blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10 6 MCF-7 cells were surface-stained with ABflo 647 Rabbit IgG isotype control (A22070,5 µl/Test,left) or TROP-2 Rabbit mAb (A241708,2.5 µg/mL,right).