Collagen II Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Collagen II Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24334
• Hersteller Artikelnummer: A24334
• Alternativnummer: ABB-A24334-100UL,ABB-A24334-20UL,ABB-A24334-500UL,ABB-A24334-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IP, WB
• Spezies Reaktivität: Human
• Immunogen: This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AOM, ANFH, SEDC, STL1, COL11A3, Collagen II

Produktbeschreibung

This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 142 kDa
• NCBI: 1280
• UniProt: P02458
• Reinheit: Affinity purification
• Sequenz: PGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQ
• Target-Kategorie: COL2A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:3000|IP, 0.5 µg - 4 µg antibody for 200 µg - 500 µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Collagen II Rabbit pAb (A24334) at 1:3000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse liver.
Exposure time: 30 s.