LGR5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24460
Artikelname: LGR5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24460
Hersteller Artikelnummer: A24460
Alternativnummer: ABB-A24460-100UL,ABB-A24460-20UL,ABB-A24460-1000UL,ABB-A24460-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, FC, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FEX, HG38, GPR49, GPR67, GRP49, LGR5
The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
NCBI: 8549
UniProt: O75473
Reinheit: Affinity purification
Sequenz: CAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTS
Target-Kategorie: LGR5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using LGR5 Rabbit pAb (A24460) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.