RAP1B Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RAP1B Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24472
• Hersteller Artikelnummer: A24472
• Alternativnummer: ABB-A24472-20UL,ABB-A24472-100UL,ABB-A24472-1000UL,ABB-A24472-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RAP1B, K-REV, RAL1B, ras-related protein Rap-1b

Produktbeschreibung

This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 15kDa/16kDa/18kDa/20kDa
• NCBI: 5908
• UniProt: P61224
• Reinheit: Affinity purification
• Sequenz: VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC
• Target-Kategorie: RAP1B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Signal Transduction,G2/M DNA Damage Checkpoint,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Cell Adhesion,Endocrine & Metabolism,Immunology & Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat brain, using RAP1B Rabbit pAb (A24472) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.