PKACalpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24483
Artikelname: PKACalpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24483
Hersteller Artikelnummer: A24483
Alternativnummer: ABB-A24483-20UL,ABB-A24483-100UL,ABB-A24483-1000UL,ABB-A24483-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PRKACA, PKACA, PPNAD4, cAMP-dependent protein kinase catalytic subunit alpha, PKACalpha
This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushings syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.
Klonalität: Polyclonal
Molekulargewicht: 39kDa/40kDa
NCBI: 5566
UniProt: P17612
Reinheit: Affinity purification
Sequenz: IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Target-Kategorie: PRKACA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G2/M DNA Damage Checkpoint,Kinase,Serine/threonine kinases,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Actins,Hedgehog Signaling Pathway,Endocrine & Metabolism,Lipid Metabolism,Carbohydrate metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Immunology & Inflammation,NF-kB Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates, using PKACalpha Rabbit pAb (A24483) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.