CD105 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD105 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24488
• Hersteller Artikelnummer: A24488
• Alternativnummer: ABB-A24488-100UL,ABB-A24488-20UL,ABB-A24488-1000UL,ABB-A24488-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Endo, CD105, S-endoglin

Produktbeschreibung

Enables protein homodimerization activity and transforming growth factor beta binding activity. Involved in several processes, including circulatory system development, positive regulation of cell differentiation, and regulation of gene expression. Acts upstream of or within circulatory system development and positive regulation of angiogenesis. Located in endothelial microparticle. Is expressed in several structures, including brain, cardiovascular system, extraembryonic vascular system, and lung. Used to study arteriovenous malformations of the brain and hereditary hemorrhagic telangiectasia. Human ortholog(s) of this gene implicated in arteriovenous malformation, arteriovenous malformations of the brain, breast cancer, hereditary hemorrhagic telangiectasia, and intracranial aneurysm. Orthologous to human ENG (endoglin).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 70kDa
• NCBI: 13805
• UniProt: Q63961
• Reinheit: Affinity purification
• Sequenz: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI
• Target-Kategorie: Eng
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using CD105 Rabbit pAb (A24488) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):NIH/3T3
Exposure time: 5s.