GTF2IRD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24506
Artikelname: GTF2IRD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24506
Hersteller Artikelnummer: A24506
Alternativnummer: ABB-A24506-20UL,ABB-A24506-100UL,ABB-A24506-500UL,ABB-A24506-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GTF2IRD1, BEN, CREAM1, GTF3, MUSTRD1, RBAP2, WBS, WBSCR11, WBSCR12, hMusTRD1alpha1, GTF2I repeat domain containing 1
The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 104kDa/106kDa/107kDa
NCBI: 9569
UniProt: Q9UHL9
Reinheit: Affinity purification
Sequenz: SLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKV
Target-Kategorie: GTF2IRD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using GTF2IRD1 Rabbit pAb (A24506) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.