SOX13 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SOX13 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24507
• Hersteller Artikelnummer: A24507
• Alternativnummer: ABB-A24507-100UL,ABB-A24507-20UL,ABB-A24507-500UL,ABB-A24507-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SOX13, ICA12, Sox-13, SRY-box 13

Produktbeschreibung

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 69kDa
• NCBI: 9580
• UniProt: Q9UN79
• Reinheit: Affinity purification
• Sequenz: RQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR
• Target-Kategorie: SOX13
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using SOX13 Rabbit pAb (A24507) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.