LAP2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: LAP2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24875
• Hersteller Artikelnummer: A24875
• Alternativnummer: ABB-A24875-100UL,ABB-A24875-20UL,ABB-A24875-1000UL,ABB-A24875-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin

Produktbeschreibung

The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa/50kDa/75kDa
• NCBI: 7112
• UniProt: P42166
• Reinheit: Affinity purification
• Sequenz: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSS
• Target-Kategorie: TMPO
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Intermediate Filaments. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat thymus usingLAP2 Rabbit pAb (A24875) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 135s.