CD146 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD146 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25042
• Hersteller Artikelnummer: A25042
• Alternativnummer: ABB-A25042-20UL,ABB-A25042-100UL,ABB-A25042-500UL,ABB-A25042-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD146, MUC18, HEMCAM, METCAM, MelCAM

Produktbeschreibung

Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 72kDa
• NCBI: 4162
• UniProt: P43121
• Reinheit: Affinity purification
• Sequenz: STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
• Target-Kategorie: MCAM
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates usingCD146 Rabbit pAb (A25042) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):COLO 205.
Exposure time:90s.