CD11b Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD11b Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25176
• Hersteller Artikelnummer: A25176
• Alternativnummer: ABB-A25176-20UL,ABB-A25176-100UL,ABB-A25176-1000UL,ABB-A25176-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CR3A, MO1A, CD11B, MAC-1, MAC1A, SLEB6, CD11b/ITGAM

Produktbeschreibung

This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 (Mac-1), or inactivated-C3b (iC3b) receptor 3 (CR3). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 127kDa
• NCBI: 3684
• UniProt: P11215
• Reinheit: Affinity purification
• Sequenz: MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
• Target-Kategorie: ITGAM
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Neuroscience, Cell Type Marker,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from RAW 264.7 cells usingCD11b Rabbit pAb (A25176) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:0.5s.