ENPP2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ENPP2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2522
• Hersteller Artikelnummer: A2522
• Alternativnummer: ABB-A2522-20UL,ABB-A2522-100UL,ABB-A2522-500UL,ABB-A2522-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IALPHA, ENPP2

Produktbeschreibung

The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5 end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 99kDa
• NCBI: 5168
• UniProt: Q13822
• Reinheit: Affinity purification
• Sequenz: DLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEE
• Target-Kategorie: ENPP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Lipases,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Angiogenesis,Heart,Lipids,Cardiovascular diseases,Heart disease. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ENPP2 Rabbit pAb (A2522) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.